
SimulationCraft 406-13

for World of Warcraft 4.0.6 Live (build level 13623)

Table of Contents

Raid Summary

DPS Chart Gear Chart Timeline Distribution Chart
DPET Chart

EvilTwinPTR : 28844dps

Results, Spec and Gear

DPS Error Range Convergence DPR RPS Out RPS In Resource Waiting APM
28844.4 16.5 / 0.1% 3067.8 / 10.6% 69.9% 2119.8 13.6 13.7 runic_power 5.53% 60.2
  • horn_of_winter
  • frost_strike
  • howling_blast
  • obliterate

Charts,s,333333&chd=t:31541|23810|17960|7279|3771|1681|374&chds=0,63083&chco=C79C6E,2459FF,2459FF,C79C6E,C79C6E,C79C6E,C79C6E&chm=t++31541++obliterate,C79C6E,0,0,15|t++23810++frost_strike,2459FF,1,0,15|t++17960++howling_blast,2459FF,2,0,15|t++7279++plague_strike,C79C6E,3,0,15|t++3771++melee_main_hand,C79C6E,4,0,15|t++1681++melee,C79C6E,5,0,15|t++374++melee,C79C6E,6,0,15&chtt=EvilTwinPTR+Damage+Per+Execute+Time&chts=dddddd,18,s,333333&chd=t:35,28,13,12,3,3,2,2,0,0,0&chds=0,100&chco=2459FF,C79C6E,C79C6E,2459FF,2459FF,9482C9,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E&chl=frost_strike|obliterate|melee_main_hand|howling_blast|frost_fever|blood_plague|claw|melee|plague_strike|melee|claw&chtt=EvilTwinPTR+Damage+Sources&chts=dddddd,18,s,333333&chd=t:47,32,16,2,2,1,0&chds=0,100&chco=C41F3B&chl=rune_abilities|chill_of_the_grave|might_of_the_frozen_wastes|improved_frost_presence|horn_of_winter|butchery|power_refund&chtt=EvilTwinPTR+Resource+Gains&chts=dddddd,18,s,333333&chg=100,20&chd=s:Qhx82snmjnponkiilnmkigfjlkigfehlliffefhjhgedeeggfdcbccddbaaaYXXXXZabcdcbaabbcbaZZZaaaaYYXYYZYXWWWXZYXVVUVVWWWVUUVWWWVVUVWUSRRRSUVVWXYYZZaZYYXYYZZYXXXXYYYXXWWXYYXWVWWXXXVVUVVWXWWVVVWWVTSSSTUWWWVWWXYabaaaaabaZYYYZZZYXXXYYZYXXXXYYYYYYYYYYYXXXXYYYWVUUVVWWWWXXYYYYYYYYacccbbbccbbbaaabbbaaaaaaaaaaaaaaabbaaZZZYXWWVVVWWWWXXYYYYYZZaabbbbcefffffffgggggggghhhhhhhhhhhggghhihhgffeeeeeeeefffffefeeeeeeeeeeeeefgghhgg&chds=0,60&chxt=x,y&chxl=0:|0|sec=403|1:|0|max=123&chtt=EvilTwinPTR+Runic Power+Timeline&chts=dddddd,18&chco=C41F3B,s,333333&chg=100,20&chd=s:z01223345558777777766432210zyxvvuuuttttssstssssssrrrrrqqqqqqrrqqrqrqqqqqqppqppoonnmmmllkkjjjjiiiiiiiiiijjjjjkklllmmmnnnnnnoooopppqqqqqqqqqpppppoonnmmmlllkkjjjijiiiiiiiiiiiiihiiiijjjkklllkllmmnnoooppppqpqqqqqrrrrrrrrrrrsssrssssssssssstssssssssttttttttttssssssrrrrqqqqpppooooooooooooononnnnmmmmmmmmmmmmmmmmnnnooppqqqrrsssssssssssssssssssssssttuuuuuuuuuuttssssssssssttttuuvvwxxyzzz000000zzyyyxxxwwwvvvuuuuu&chco=FDD017&chds=0,60&chxt=x,y&chxl=0:|0|sec=403|1:|0|avg=28844|max=40154&chxp=1,1,72,100&chtt=EvilTwinPTR+DPS+Timeline&chts=dddddd,18,s,333333&chg=100,100&chd=t:3,4,6,8,20,28,40,63,80,115,124,178,262,295,377,415,473,543,608,629,635,596,612,551,488,398,437,382,325,254,221,182,158,108,103,72,51,46,27,16,23,12,12,6,3,5,0,2,2,2&chds=0,635&chbh=5&chxt=x&chxl=0:|min=26272|avg=28844|max=32408&chxp=0,1,42,100&chtt=EvilTwinPTR+DPS+Distribution&chts=dddddd,18


Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Max Crit% M% D% P% G% B% Ticks T-Hit T-Crit T-Crit% T-M% Up%
EvilTwinPTR 28844
blood_plague 789 2.7% 12.7 33.04sec 25028 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0% 0.0% 133 2059 4304 14.5% 0.0% 99.2%

Stats details: blood_plague

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
12.71 12.71 133.37 133.37 0.0000 3.0000 318088
Direct Results Count Pct Average Min Max Total Damage
hit 12.7 100.00% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 114.0 85.47% 2058.90 1579 3363 234694
crit 19.4 14.53% 4304.09 3300 7029 83394

Action details: blood_plague

Static Values
  • id:59879
  • school:shadow
  • resource:unknown
  • tree:Unknown
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:A disease dealing ${$m1*1.15+$AP*0.055*1.15} Shadow damage every 3 sec for $55078d. Caused by Plague Strike and other abilities.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.063250
  • base_td:1.00
  • num_ticks:11
  • base_tick_time:3.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:0.00
blood_tap 0 0.0% 6.3 67.08sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: blood_tap

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
6.30 6.30 0.00 0.00 0.0000 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 6.3 100.00% 0.00 0 0 0

Action details: blood_tap

Static Values
  • id:45529
  • school:physical
  • resource:health
  • tree:blood
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:60.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Blood Rune converted to a Death Rune.
  • description:Immediately activates a Blood Rune and converts it into a Death Rune for the next $d. Death Runes count as a Blood, Frost or Unholy Rune.
Rune Information
  • Blood Cost:1
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:0.00
empower_rune_weapon 0 0.0% 1.8 311.66sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: empower_rune_weapon

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
1.76 1.76 0.00 0.00 0.0000 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 1.8 100.00% 0.00 0 0 0

Action details: empower_rune_weapon

Static Values
  • id:47568
  • school:physical
  • resource:unknown
  • tree:Unknown
  • range:0.0
  • travel_speed:4.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:300.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Empower your rune weapon, immediately activating all your runes and generating 25 runic power.
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:25.00
frost_fever 961 3.3% 86.8 4.66sec 4459 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0% 0.0% 134 2679 4141 14.5% 0.0% 99.7%

Stats details: frost_fever

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
86.85 86.85 133.96 133.96 0.0000 3.0000 387289
Direct Results Count Pct Average Min Max Total Damage
hit 86.8 100.00% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 114.5 85.50% 2679.08 2033 4373 306862
crit 19.4 14.50% 4140.91 3141 6756 80427

Action details: frost_fever

Static Values
  • id:59921
  • school:frost
  • resource:unknown
  • tree:Unknown
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:A disease dealing ${$m1*1.15+$AP*0.055*1.15} Frost damage every 3 sec and reducing the target's melee and ranged attack speed by $55095s2% for $55095d. Caused by Icy Touch and other spells.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.063250
  • base_td:1.00
  • num_ticks:11
  • base_tick_time:3.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:0.00
frost_strike 10193 35.3% 171.5 2.33sec 23969 23810 18121 37251 56430 30.6% 0.0% 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: frost_strike

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
171.46 171.46 0.00 0.00 1.0067 0.0000 4109676
Direct Results Count Pct Average Min Max Total Damage
hit 118.9 69.34% 18120.83 14694 27393 2154190
crit 52.5 30.62% 37251.11 30269 56430 1955486
miss 0.1 0.05% 0.00 0 0 0

Action details: frost_strike

Static Values
  • id:49143
  • school:frost
  • resource:runic_power
  • tree:frost
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:32.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.05
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Instantly strike the enemy, causing $s2% weapon damage plus ${$m1*$m2/100} as Frost damage.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:277.93
  • base_dd_max:277.93
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:0.00
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.30
howling_blast 3603 12.5% 80.3 4.95sec 18102 17960 15634 32659 54648 14.5% 0.0% 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: howling_blast

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
80.26 80.26 0.00 0.00 1.0079 0.0000 1452796
Direct Results Count Pct Average Min Max Total Damage
hit 68.6 85.50% 15634.28 12062 26148 1072865
crit 11.6 14.50% 32658.63 25008 54648 379931

Action details: howling_blast

Static Values
  • id:49184
  • school:frost
  • resource:unknown
  • tree:frost
  • range:20.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Blast the target with a frigid wind, dealing ${(($m2+$M2)/2)+($AP*0.48)} Frost damage to that foe, and ${(0.5*((($m2+$M2)/2)+($AP*0.48)))} Frost damage to all other enemies within $A2 yards.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.400000
  • base_dd_min:1369.63
  • base_dd_max:1513.20
Rune Information
  • Blood Cost:0
  • Frost Cost:1
  • Unholy Cost:0
  • Runic Power Gain:10.00
melee_main_hand 3763 13.0% 199.4 2.03sec 7610 3771 7547 15555 22261 6.5% 0.0% 0.0% 0.0% 24.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: melee_main_hand

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
199.40 199.40 0.00 0.00 2.0182 0.0000 1517340
Direct Results Count Pct Average Min Max Total Damage
hit 138.5 69.45% 7547.21 6245 10806 1045160
crit 12.9 6.49% 15555.01 12864 22261 201195
glance 47.9 24.01% 5659.41 4684 8105 270985
miss 0.1 0.05% 0.00 0 0 0

Action details: melee_main_hand

Static Values
  • id:0
  • school:physical
  • resource:none
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:3.80
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:0.00
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
obliterate 8099 28.1% 102.6 3.94sec 31838 31541 24378 50696 74677 28.4% 0.0% 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: obliterate

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
102.57 102.57 0.00 0.00 1.0094 0.0000 3265531
Direct Results Count Pct Average Min Max Total Damage
hit 73.4 71.56% 24377.80 19846 36251 1789333
crit 29.1 28.39% 50695.53 40883 74677 1476198
miss 0.0 0.05% 0.00 0 0 0

Action details: obliterate

Static Values
  • id:49020
  • school:physical
  • resource:unknown
  • tree:frost
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:A brutal instant attack that deals $s2% weapon damage plus ${$m1*$m2/100}. Total damage is increased by ${$m3/2}.1% for each of your diseases on the target.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:650.38
  • base_dd_max:650.38
Rune Information
  • Blood Cost:0
  • Frost Cost:1
  • Unholy Cost:1
  • Runic Power Gain:20.00
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.60
outbreak 0 0.0% 6.6 66.02sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: outbreak

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
6.59 6.59 0.00 0.00 1.0149 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
hit 6.6 100.00% 0.00 0 0 0

Action details: outbreak

Static Values
  • id:77575
  • school:shadow
  • resource:mana
  • tree:unholy
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:0.0
  • cooldown:60.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Instantly applies Blood Plague and Frost Fever to the target enemy.
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:0.00
pillar_of_frost 0 0.0% 7.1 61.22sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: pillar_of_frost

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
7.10 7.10 0.00 0.00 0.0000 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 7.1 100.00% 0.00 0 0 0

Action details: pillar_of_frost

Static Values
  • id:51271
  • school:physical
  • resource:unknown
  • tree:frost
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:60.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Strength increased by $s1%. Immune to movement from external sources.
  • description:Calls upon the power of Frost to increase the Death Knight's Strength by $s1%. Icy crystals hang heavy upon the Death Knight's body, providing immunity against external movement such as knockbacks. Lasts $d.
Rune Information
  • Blood Cost:0
  • Frost Cost:1
  • Unholy Cost:0
  • Runic Power Gain:10.00
plague_strike 111 0.4% 6.1 66.32sec 7344 7279 6878 14149 20142 6.4% 0.0% 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: plague_strike

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
6.12 6.12 0.00 0.00 1.0089 0.0000 44935
Direct Results Count Pct Average Min Max Total Damage
hit 5.7 93.52% 6877.90 6117 9778 39356
crit 0.4 6.44% 14149.42 12601 20142 5579
miss 0.0 0.04% 0.00 0 0 0

Action details: plague_strike

Static Values
  • id:45462
  • school:physical
  • resource:unknown
  • tree:unholy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:A vicious strike that deals $% weapon damage plus $ and infects the target with Blood Plague, a disease dealing Shadow damage over time.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:420.84
  • base_dd_max:420.84
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:1
  • Runic Power Gain:10.00
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
pet - army_of_the_dead_ghoul_8 616
claw 248 40.2% 13.0 2.78sec 667 0 647 1293 1293 9.2% 0.0% 0.0% 0.0% 23.8% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: claw

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
13.00 13.00 0.00 0.00 0.0000 0.0000 8676
Direct Results Count Pct Average Min Max Total Damage
hit 8.7 66.90% 646.68 647 647 5624
crit 1.2 9.21% 1293.37 1293 1293 1548
glance 3.1 23.85% 485.01 485 485 1504
miss 0.0 0.05% 0.00 0 0 0

Action details: claw

Static Values
  • id:91776
  • school:physical
  • resource:energy
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:40.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
  • normalized:false
  • weapon_power_mod:0.060000
  • weapon_multiplier:1.25
melee 368 59.8% 24.0 1.44sec 537 374 520 1041 1041 9.3% 0.0% 0.0% 0.0% 24.1% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
24.00 24.00 0.00 0.00 1.4365 0.0000 12890
Direct Results Count Pct Average Min Max Total Damage
hit 16.0 66.60% 520.31 520 520 8317
crit 2.2 9.28% 1040.62 1041 1041 2319
glance 5.8 24.07% 390.23 390 390 2255
miss 0.0 0.04% 0.00 0 0 0

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
  • normalized:false
  • weapon_power_mod:0.060000
  • weapon_multiplier:1.00
pet - ghoul 1431
claw 737 51.5% 95.1 3.71sec 2776 0 2814 5627 7207 9.2% 0.1% 4.5% 0.0% 24.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: claw

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
95.09 95.09 0.00 0.00 0.0000 0.0000 264006
Direct Results Count Pct Average Min Max Total Damage
hit 59.2 62.21% 2814.32 1821 3604 166490
crit 8.8 9.23% 5626.66 3642 7207 49377
glance 22.8 23.98% 2110.93 1366 2703 48139
dodge 4.3 4.52% 0.00 0 0 0
miss 0.0 0.05% 0.00 0 0 0

Action details: claw

Static Values
  • id:91776
  • school:physical
  • resource:energy
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:40.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
  • normalized:false
  • weapon_power_mod:0.060000
  • weapon_multiplier:1.25
melee 695 48.5% 111.9 3.12sec 2224 1681 2256 4509 5767 9.2% 0.1% 4.5% 0.0% 24.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
111.93 111.93 0.00 0.00 1.3235 0.0000 248960
Direct Results Count Pct Average Min Max Total Damage
hit 69.7 62.28% 2255.78 1458 2884 157235
crit 10.3 9.16% 4509.15 2915 5767 46230
glance 26.9 24.04% 1690.46 1093 2163 45495
dodge 5.0 4.47% 0.00 0 0 0
miss 0.1 0.05% 0.00 0 0 0

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:energy
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
  • normalized:false
  • weapon_power_mod:0.060000
  • weapon_multiplier:1.00
Resource Usage Res% DPR RPE
frost_strike 100.0% 749.0 32
pet - army_of_the_dead_ghoul_8
claw 100.0% 16.7 40
pet - ghoul
claw 100.0% 69.4 40


Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
blood_fury_ap 3.8 0.0 120.5sec 120.5sec 14% 14%

Database details

  • id:
  • cooldown name:buff_blood_fury_ap
  • tooltip:(null)
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
bloodlust 1.0 0.0 0.0sec 0.0sec 10% 10%

Database details

  • id:
  • cooldown name:buff_bloodlust
  • tooltip:(null)
  • max_stacks:1
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
crushing_weight 7.3 0.0 58.1sec 58.1sec 27% 27%

Database details

  • id:
  • cooldown name:buff_crushing_weight
  • tooltip:(null)
  • max_stacks:1
  • duration:15.00
  • cooldown:50.00
  • default_chance:10.00%
golemblood_potion 2.0 0.0 315.7sec 315.7sec 11% 11%

Database details

  • id:
  • cooldown name:buff_golemblood_potion
  • tooltip:(null)
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
heart_of_rage 4.2 0.0 108.1sec 108.1sec 20% 20%

Database details

  • id:
  • cooldown name:buff_heart_of_rage
  • tooltip:(null)
  • max_stacks:1
  • duration:20.00
  • cooldown:100.00
  • default_chance:10.00%
killing_machine 61.3 1.7 6.5sec 6.4sec 14% 22%

Database details

  • id:
  • cooldown name:buff_killing_machine
  • tooltip:(null)
  • max_stacks:1
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
pillar_of_frost 7.1 0.0 61.2sec 61.2sec 34% 35%

Database details

  • id:
  • cooldown name:buff_pillar_of_frost
  • tooltip:(null)
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
rime 43.2 2.8 9.3sec 8.7sec 19% 54%

Database details

  • id:
  • cooldown name:buff_rime
  • tooltip:(null)
  • max_stacks:1
  • duration:30.00
  • cooldown:0.00
  • default_chance:45.00%
rune_of_the_fallen_crusader 6.8 53.9 59.2sec 6.6sec 90% 88%

Database details

  • id:
  • cooldown name:buff_rune_of_the_fallen_crusader
  • tooltip:(null)
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
tier11_4pc_melee 1.0 112.1 0.0sec 3.5sec 99% 100%

Database details

  • id:
  • cooldown name:buff_tier11_4pc_melee
  • tooltip:(null)
  • max_stacks:3
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
ghoul-bloodlust 0.5 0.0 0.0sec 0.0sec 3% 3%

Database details

  • id:
  • cooldown name:buff_bloodlust
  • tooltip:(null)
  • max_stacks:1
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
Constant Buffs

Database details

  • id:
  • cooldown name:buff_arcane_brilliance
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%

Database details

  • id:
  • cooldown name:buff_blessing_of_kings
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%

Database details

  • id:
  • cooldown name:buff_blessing_of_might
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%

Database details

  • id:
  • cooldown name:buff_blessing_of_might_regen
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%

Database details

  • id:54646
  • cooldown name:buff_focus_magic
  • tooltip:Chance to critically hit with spells increased by $s1%. When a critical hit occurs, the caster's chance to critically hit is increased.
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%

Database details

  • id:
  • cooldown name:buff_fortitude
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%

Database details

  • id:57669
  • cooldown name:buff_replenishment
  • tooltip:Replenishes $s1% of maximum mana per 10 sec.
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%

Database details

  • id:
  • cooldown name:buff_unholy_presence
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%




Count Interval
runic_empowerment 76.6 5.2sec
runic_empowerment_wasted 0.5 125.9sec


Count runic_power Average Overflow
butchery 1613.0 79.5 0.0 1.4%
chill_of_the_grave 182.8 1786.9 9.8 2.2%
horn_of_winter 9.1 91.2 10.0 0.0%
improved_frost_presence 155.7 104.5 0.7 0.6%
might_of_the_frozen_wastes 89.6 882.8 9.9 1.5%
power_refund 0.1 2.3 28.8 0.0%
rune_abilities 155.7 2592.3 16.6 1.4%
pet - army_of_the_dead_ghoul_8 energy
energy_regen 443.0 0.0%
pet - ghoul energy
energy_regen 3582.0 0.0%

Action Priority List

# action,conditions
0 flask,type=titanic_strength
1 food,type=beer_basted_crocolisk
2 presence,choose=unholy
3 army_of_the_dead
4 snapshot_stats
5 blood_fury,time>=10
6 golemblood_potion,if=!in_combat|buff.bloodlust.react|target.time_to_die<=60
7 auto_attack
8 pillar_of_frost
9 raise_dead,if=buff.heart_of_rage.react&buff.rune_of_the_fallen_crusader.react
A raise_dead,time>=15
B outbreak,if=dot.frost_fever.remains<=2|dot.blood_plague.remains<=2
C howling_blast,if=dot.frost_fever.remains<=2
D plague_strike,if=dot.blood_plague.remains<=2
E obliterate,if=frost=2&unholy=2
F obliterate,if=death=2
G obliterate,if=buff.killing_machine.react
H blood_tap,if=buff.killing_machine.react
I empower_rune_weapon,if=target.time_to_die<=120&buff.killing_machine.react
J blood_strike,if=blood=2
K frost_strike,if=runic_power>=90&!buff.bloodlust.react
L frost_strike,if=runic_power>=95
M howling_blast,if=buff.rime.react
N howling_blast,if=(death+unholy)=0
O obliterate
P empower_rune_weapon,if=target.time_to_die<=45
Q frost_strike
R howling_blast
S blood_tap
T blood_strike,if=death=0
U empower_rune_weapon
V horn_of_winter

Sample Sequence



Raid-Buffed Unbuffed Gear Amount
Strength 7046 5685 5012
Agility 721 138 20
Stamina 7063 6053 5863
Intellect 55 53 20
Spirit 85 85 20
Health 141837 127767 0
Mana 120 120 0
Spell Power 0 0 0
Spell Hit 18.32% 18.32% 955
Spell Crit 11.29% 3.29% 590
Spell Haste 20.82% 15.06% 1929
Spell Penetration 0 0 0
Mana Per 5 0 0 0
Attack Power 16745 12501 190
Melee Hit 7.95% 7.95% 955
Melee Crit 11.25% 3.86% 590
Melee Haste 26.57% 15.06% 1929
Expertise 26.24 26.24 788
Armor 21168 21168 21168
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 5.34% 3.98% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 15.01 15.01 1257


head magma_plated_helmet,heroic=1,type=plate,ilevel=372,quality=epic,stats=2891armor_197exp_257haste_578sta_325str,reforge=exp_hit,gems=reverberating_shadowspirit_20haste_20str_30str,enchant=60str_35mastery
neck rage_of_ages,heroic=1,ilevel=372,quality=epic,stats=143hit_143mastery_322sta_215str,reforge=mastery_haste
shoulders magma_plated_pauldrons,heroic=1,type=plate,ilevel=372,quality=epic,stats=2669armor_191haste_171hit_429sta_266str,gems=40str_10haste,enchant=50str_25crit
shirt empty
chest battleplate_of_ancient_kings,heroic=1,type=plate,ilevel=372,quality=epic,stats=3559armor_217exp_257haste_578sta_345str,reforge=exp_mastery,gems=40str_40str,enchant=20all
waist sky_strider_belt_of_the_faultline,heroic=1,type=plate,ilevel=372,quality=epic,stats=2002armor_429sta_266str_180haste_180mastery,gems=40str_67str,suffix=223
legs magma_plated_legplates,heroic=1,type=plate,ilevel=372,quality=epic,stats=3114armor_217hit_257mastery_578sta_345str,reforge=mastery_haste,gems=40str_40str,enchant=190ap_55crit
feet massacre_treads,heroic=1,type=plate,ilevel=372,quality=epic,stats=2447armor_171exp_191mastery_429sta_266str,reforge=exp_haste,gems=40str,enchant=50haste
wrists bracers_of_the_matredor,heroic=1,type=plate,ilevel=379,quality=epic,stats=1589armor_153crit_113haste_344sta_229str,reforge=crit_hit,gems=40str_67str,enchant=50str
hands magma_plated_gauntlets,heroic=1,type=plate,ilevel=372,quality=epic,stats=2224armor_191haste_171mastery_429sta_266str,gems=40str_67str,enchant=50str
finger1 dargonaxs_signet,heroic=1,ilevel=379,quality=epic,stats=113crit_153mastery_344sta_229str,reforge=crit_haste,gems=40str
finger2 ring_of_rivalry,heroic=1,ilevel=372,quality=epic,stats=143haste_143mastery_322sta_215str
trinket1 crushing_weight,heroic=1,ilevel=372,quality=epic,stats=363str,equip=onattackhit_2178haste_10%_15dur_50cd
trinket2 heart_of_rage,heroic=1,ilevel=372,quality=epic,stats=363exp,equip=onattackhit_2178str_10%_20dur_100cd
back glittering_epidermis,heroic=1,ilevel=372,quality=epic,stats=673armor_143crit_143haste_322sta_215str,reforge=crit_mastery,enchant=65crit
main_hand reclaimed_ashkandi_greatsword_of_the_brotherhood,heroic=1,ilevel=372,quality=epic,stats=257crit_257hit_578sta_385str,reforge=crit_haste,enchant=rune_of_the_fallen_crusader,weapon=sword2h_3.80speed_2138min_3209max
off_hand empty
ranged relic_of_aggramar,ilevel=359,quality=epic,stats=72crit_72exp_161sta_107str,reforge=crit_hit,gems=40str
tabard tabard_of_ramkahen,ilevel=85


Blood Rank
Butchery 1
Blade Barrier 0
Bladed Armor 3
Improved Blood Tap 0
Scent of Blood 0
Scarlet Fever 0
Hand of Doom 0
Blood-Caked Blade 0
Bone Shield 0
Toughness 0
Abomination's Might 0
Sanguine Fortitude 0
Blood Parasite 0
Improved Blood Presence 0
Will of the Necropolis 0
Rune Tap 0
Vampiric Blood 0
Improved Death Strike 0
Crimson Scourge 0
Dancing Rune Weapon 0
Frost Rank
Runic Power Mastery 3
Icy Reach 2
Nerves of Cold Steel 0
Annihilation 3
Lichborne 1
On a Pale Horse 0
Endless Winter 1
Merciless Combat 2
Chill of the Grave 2
Killing Machine 3
Rime 3
Pillar of Frost 1
Improved Icy Talons 1
Brittle Bones 2
Chilblains 0
Hungering Cold 1
Improved Frost Presence 2
Threat of Thassarian 0
Might of the Frozen Wastes 3
Howling Blast 1
Unholy Rank
Unholy Command 0
Virulence 3
Epidemic 3
Desecration 0
Resilient Infection 0
Morbidity 0
Runic Corruption 0
Unholy Frenzy 0
Contagion 0
Shadow Infusion 0
Death's Advance 0
Magic Suppression 0
Rage of Rivendare 0
Unholy Blight 0
Anti-Magic Zone 0
Improved Unholy Presence 0
Dark Transformation 0
Ebon Plaguebringer 0
Sudden Doom 0
Summon Gargoyle 0



# Gear Summary # gear_strength=5012
# gear_agility=20
# gear_stamina=5863
# gear_intellect=20
# gear_spirit=20
# gear_attack_power=190
# gear_expertise_rating=788
# gear_hit_rating=955
# gear_crit_rating=590
# gear_haste_rating=1929
# gear_mastery_rating=1257
# gear_armor=21168
# meta_gem=reverberating_shadowspirit
# tier11_2pc_melee=1
# tier11_4pc_melee=1
# main_hand=reclaimed_ashkandi_greatsword_of_the_brotherhood,heroic=1,weapon=sword2h_3.80speed_2138min_3209max,enchant=rune_of_the_fallen_crusader

death_knight_frost_2h_t11_372 : 25548dps

Results, Spec and Gear

DPS Error Range Convergence DPR RPS Out RPS In Resource Waiting APM
25547.9 15.6 / 0.1% 2934.7 / 11.5% 70.5% 1998.5 12.8 12.9 runic_power 6.81% 59.5
  • horn_of_winter
  • frost_strike
  • howling_blast
  • obliterate

Charts,s,333333&chd=t:32382|20333|17519|7637|7259|3759|1667|374&chds=0,64763&chco=C79C6E,2459FF,2459FF,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E&chm=t++32382++obliterate,C79C6E,0,0,15|t++20333++frost_strike,2459FF,1,0,15|t++17519++howling_blast,2459FF,2,0,15|t++7637++blood_strike,C79C6E,3,0,15|t++7259++plague_strike,C79C6E,4,0,15|t++3759++melee_main_hand,C79C6E,5,0,15|t++1667++melee,C79C6E,6,0,15|t++374++melee,C79C6E,7,0,15&chtt=death_knight_frost_2h_t11_372+Damage+Per+Execute+Time&chts=dddddd,18,s,333333&chd=t:32,27,15,12,4,3,3,3,2,0,0,0&chds=0,100&chco=2459FF,C79C6E,C79C6E,2459FF,2459FF,9482C9,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E&chl=frost_strike|obliterate|melee_main_hand|howling_blast|frost_fever|blood_plague|blood_strike|claw|melee|plague_strike|melee|claw&chtt=death_knight_frost_2h_t11_372+Damage+Sources&chts=dddddd,18,s,333333&chd=t:49,29,17,2,2,2,0&chds=0,100&chco=C41F3B&chl=rune_abilities|chill_of_the_grave|might_of_the_frozen_wastes|improved_frost_presence|horn_of_winter|butchery|power_refund&chtt=death_knight_frost_2h_t11_372+Resource+Gains&chts=dddddd,18,s,333333&chg=100,20&chd=s:Wt57682yu0432yuvz10wtposvusponrvxvqomnpsqpnmmnqqpllkllnmkihhfdcccefiklkjihijkihgffhihgeedffgfdcccdgfebaYaabbaZYYZbbbaZZaaZWUUUVXZabcdeeffgedcddeedcccceeecbabcddcbZabcccaZYYZabaaZZZbaZXWVVWXZZaabbcdfhggfgghffdddefeedccddedcbcccdddcddddddcbbccdcbZZYYYZZaaabcdddcdddfhihhhiiiiihggghhhggfgfggfffffffgggffffedcbaaaZZZZaabcddddeeggggghikmnnnnnoppppppqqrrrrrrrrssrrqrrrrrrrqqpommllllmmnnnmnnnmmmmmmmmllmnoopppp&chds=0,60&chxt=x,y&chxl=0:|0|sec=403|1:|0|max=92&chtt=death_knight_frost_2h_t11_372+Runic Power+Timeline&chts=dddddd,18&chco=C41F3B,s,333333&chg=100,20&chd=s:yz011233454767877665533210zyxwvvuuttsssssrsssrsrrrrrrrpqpqqqqqqqqqqpqppppoopoonnmmlllkkjjjiiihhhhhhhhhhhhihiijjjjkkkkkllllmmmmnnnoooopppppooooonnmmllllkkjjiiihhhhhhhhhhhggggggggghhhiijjjjjkkllmmnnoopppppppppqqqqqqqqqqqrrrqrrrrrrrrrrrrrrqqqqqqqqqqrqrrrrqqqqqqqqqqppppoooonnnnnnnmmmmmmmmmlllllllllkkkkkkkkkkkllmmmnnooppqqqqqrrrrsrsssssssssssssttttttttttsssrrrrrrqrrrrrrssttuuvwwxxyyyzzzyyyyxxxwwwwvvvuuutt&chco=FDD017&chds=0,60&chxt=x,y&chxl=0:|0|sec=403|1:|0|avg=25548|max=36624&chxp=1,1,70,100&chtt=death_knight_frost_2h_t11_372+DPS+Timeline&chts=dddddd,18,s,333333&chg=100,100&chd=t:1,1,3,3,5,8,16,36,47,72,86,134,187,210,282,354,432,508,498,564,572,588,634,603,564,582,473,442,397,303,279,209,197,166,130,102,70,57,55,35,30,19,13,9,10,4,3,3,2,2&chds=0,634&chbh=5&chxt=x&chxl=0:|min=22924|avg=25548|max=28793&chxp=0,1,45,100&chtt=death_knight_frost_2h_t11_372+DPS+Distribution&chts=dddddd,18


Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Max Crit% M% D% P% G% B% Ticks T-Hit T-Crit T-Crit% T-M% Up%
death_knight_frost_2h_t11_372 25548
blood_plague 786 3.1% 12.7 33.12sec 24992 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0% 0.0% 133 2057 4297 14.5% 0.0% 99.0%

Stats details: blood_plague

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
12.68 12.68 133.06 133.06 0.0000 3.0000 316897
Direct Results Count Pct Average Min Max Total Damage
hit 12.7 100.00% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 113.8 85.49% 2056.59 1533 3363 233951
crit 19.3 14.51% 4297.44 3204 7029 82946

Action details: blood_plague

Static Values
  • id:59879
  • school:shadow
  • resource:unknown
  • tree:Unknown
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:A disease dealing ${$m1*1.15+$AP*0.055*1.15} Shadow damage every 3 sec for $55078d. Caused by Plague Strike and other abilities.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.063250
  • base_td:1.00
  • num_ticks:11
  • base_tick_time:3.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:0.00
blood_strike 687 2.7% 35.9 11.29sec 7713 7637 7223 14880 20591 6.4% 0.0% 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: blood_strike

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
35.89 35.89 0.00 0.00 1.0100 0.0000 276803
Direct Results Count Pct Average Min Max Total Damage
hit 33.6 93.50% 7222.95 5617 9996 242362
crit 2.3 6.45% 14879.89 11572 20591 34441
miss 0.0 0.05% 0.00 0 0 0

Action details: blood_strike

Static Values
  • id:45902
  • school:physical
  • resource:unknown
  • tree:blood
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Instantly strike the enemy, causing $s2% weapon damage plus $. Damage is increased by ${($m3/$m2)*100}.1% for each of your diseases on the target.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:850.67
  • base_dd_max:850.67
Rune Information
  • Blood Cost:1
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:10.00
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.80
blood_tap 0 0.0% 6.5 64.97sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: blood_tap

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
6.46 6.46 0.00 0.00 0.0000 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 6.5 100.00% 0.00 0 0 0

Action details: blood_tap

Static Values
  • id:45529
  • school:physical
  • resource:health
  • tree:blood
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:60.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Blood Rune converted to a Death Rune.
  • description:Immediately activates a Blood Rune and converts it into a Death Rune for the next $d. Death Runes count as a Blood, Frost or Unholy Rune.
Rune Information
  • Blood Cost:1
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:0.00
empower_rune_weapon 0 0.0% 1.8 310.15sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: empower_rune_weapon

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
1.76 1.76 0.00 0.00 0.0000 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 1.8 100.00% 0.00 0 0 0

Action details: empower_rune_weapon

Static Values
  • id:47568
  • school:physical
  • resource:unknown
  • tree:Unknown
  • range:0.0
  • travel_speed:4.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:300.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Empower your rune weapon, immediately activating all your runes and generating 25 runic power.
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:25.00
frost_fever 956 3.7% 74.2 5.45sec 5191 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0% 0.0% 134 2666 4121 14.5% 0.0% 99.7%

Stats details: frost_fever

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
74.24 74.24 133.96 133.96 0.0000 3.0000 385418
Direct Results Count Pct Average Min Max Total Damage
hit 74.2 100.00% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 114.5 85.50% 2666.13 1993 4373 305374
crit 19.4 14.50% 4121.45 3080 6756 80044

Action details: frost_fever

Static Values
  • id:59921
  • school:frost
  • resource:unknown
  • tree:Unknown
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:A disease dealing ${$m1*1.15+$AP*0.055*1.15} Frost damage every 3 sec and reducing the target's melee and ranged attack speed by $55095s2% for $55095d. Caused by Icy Touch and other spells.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.063250
  • base_td:1.00
  • num_ticks:11
  • base_tick_time:3.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:0.00
frost_strike 8177 32.0% 161.1 2.49sec 20468 20333 15301 31421 47748 32.1% 0.0% 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: frost_strike

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
161.07 161.07 0.00 0.00 1.0067 0.0000 3296834
Direct Results Count Pct Average Min Max Total Damage
hit 109.3 67.85% 15300.91 12292 23179 1672280
crit 51.7 32.10% 31420.83 25322 47748 1624554
miss 0.1 0.05% 0.00 0 0 0

Action details: frost_strike

Static Values
  • id:49143
  • school:frost
  • resource:runic_power
  • tree:frost
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:32.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.05
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Instantly strike the enemy, causing $s2% weapon damage plus ${$m1*$m2/100} as Frost damage.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:277.93
  • base_dd_max:277.93
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:0.00
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.10
howling_blast 2961 11.6% 67.7 5.88sec 17646 17519 15243 31872 53839 14.4% 0.0% 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: howling_blast

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
67.66 67.66 0.00 0.00 1.0072 0.0000 1193974
Direct Results Count Pct Average Min Max Total Damage
hit 57.9 85.55% 15243.50 11426 25760 882371
crit 9.8 14.45% 31872.25 23881 53839 311602

Action details: howling_blast

Static Values
  • id:49184
  • school:frost
  • resource:unknown
  • tree:frost
  • range:20.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Blast the target with a frigid wind, dealing ${(($m2+$M2)/2)+($AP*0.4)} Frost damage to that foe, and ${(0.6*((($m2+$M2)/2)+($AP*0.4)))} Frost damage to all other enemies within $A2 yards.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.400000
  • base_dd_min:1151.87
  • base_dd_max:1251.62
Rune Information
  • Blood Cost:0
  • Frost Cost:1
  • Unholy Cost:0
  • Runic Power Gain:10.00
melee_main_hand 3752 14.7% 199.4 2.03sec 7586 3759 7527 15513 22261 6.5% 0.0% 0.0% 0.0% 24.1% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: melee_main_hand

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
199.42 199.42 0.00 0.00 2.0180 0.0000 1512747
Direct Results Count Pct Average Min Max Total Damage
hit 138.4 69.40% 7526.54 6167 10806 1041632
crit 12.9 6.47% 15512.67 12704 22261 200054
glance 48.0 24.09% 5643.09 4625 8105 271061
miss 0.1 0.05% 0.00 0 0 0

Action details: melee_main_hand

Static Values
  • id:0
  • school:physical
  • resource:none
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:3.80
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:0.00
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
obliterate 6803 26.6% 83.8 4.82sec 32717 32382 24327 50704 74677 31.9% 0.0% 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: obliterate

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
83.84 83.84 0.00 0.00 1.0104 0.0000 2743003
Direct Results Count Pct Average Min Max Total Damage
hit 57.1 68.10% 24327.22 19633 36251 1388924
crit 26.7 31.85% 50703.75 40444 74677 1354079
miss 0.0 0.05% 0.00 0 0 0

Action details: obliterate

Static Values
  • id:49020
  • school:physical
  • resource:unknown
  • tree:frost
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:A brutal instant attack that deals $s2% weapon damage plus ${$m1*$m2/100}. Total damage is increased by ${$m3/2}.1% for each of your diseases on the target.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:650.38
  • base_dd_max:650.38
Rune Information
  • Blood Cost:0
  • Frost Cost:1
  • Unholy Cost:1
  • Runic Power Gain:20.00
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.60
outbreak 0 0.0% 6.6 66.17sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: outbreak

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
6.58 6.58 0.00 0.00 1.0150 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
hit 6.6 100.00% 0.00 0 0 0

Action details: outbreak

Static Values
  • id:77575
  • school:shadow
  • resource:mana
  • tree:unholy
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:0.0
  • cooldown:60.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Instantly applies Blood Plague and Frost Fever to the target enemy.
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:0.00
pillar_of_frost 0 0.0% 7.1 61.67sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: pillar_of_frost

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
7.05 7.05 0.00 0.00 0.0000 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 7.1 100.00% 0.00 0 0 0

Action details: pillar_of_frost

Static Values
  • id:51271
  • school:physical
  • resource:unknown
  • tree:frost
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:60.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Strength increased by $s1%. Immune to movement from external sources.
  • description:Calls upon the power of Frost to increase the Death Knight's Strength by $s1%. Icy crystals hang heavy upon the Death Knight's body, providing immunity against external movement such as knockbacks. Lasts $d.
Rune Information
  • Blood Cost:0
  • Frost Cost:1
  • Unholy Cost:0
  • Runic Power Gain:10.00
plague_strike 111 0.4% 6.1 66.49sec 7324 7259 6845 14092 20142 6.7% 0.0% 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: plague_strike

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
6.10 6.10 0.00 0.00 1.0089 0.0000 44684
Direct Results Count Pct Average Min Max Total Damage
hit 5.7 93.30% 6844.75 6016 10045 38963
crit 0.4 6.65% 14091.50 12393 20142 5721
miss 0.0 0.05% 0.00 0 0 0

Action details: plague_strike

Static Values
  • id:45462
  • school:physical
  • resource:unknown
  • tree:unholy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:A vicious strike that deals $% weapon damage plus $ and infects the target with Blood Plague, a disease dealing Shadow damage over time.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:420.84
  • base_dd_max:420.84
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:1
  • Runic Power Gain:10.00
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
pet - army_of_the_dead_ghoul_8 616
claw 248 40.2% 13.0 2.78sec 667 0 647 1293 1293 9.2% 0.0% 0.0% 0.0% 24.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: claw

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
13.00 13.00 0.00 0.00 0.0000 0.0000 8671
Direct Results Count Pct Average Min Max Total Damage
hit 8.7 66.74% 646.68 647 647 5611
crit 1.2 9.19% 1293.37 1293 1293 1545
glance 3.1 24.03% 485.01 485 485 1515
miss 0.0 0.04% 0.00 0 0 0

Action details: claw

Static Values
  • id:91776
  • school:physical
  • resource:energy
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:40.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
  • normalized:false
  • weapon_power_mod:0.060000
  • weapon_multiplier:1.25
melee 368 59.8% 24.0 1.44sec 537 374 520 1041 1041 9.3% 0.0% 0.0% 0.0% 23.9% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
24.00 24.00 0.00 0.00 1.4365 0.0000 12897
Direct Results Count Pct Average Min Max Total Damage
hit 16.0 66.77% 520.31 520 520 8338
crit 2.2 9.30% 1040.62 1041 1041 2322
glance 5.7 23.88% 390.23 390 390 2237
miss 0.0 0.05% 0.00 0 0 0

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
  • normalized:false
  • weapon_power_mod:0.060000
  • weapon_multiplier:1.00
pet - ghoul 1420
claw 731 51.5% 95.2 3.70sec 2752 0 2789 5587 7207 9.2% 0.0% 4.5% 0.0% 24.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: claw

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
95.16 95.16 0.00 0.00 0.0000 0.0000 261839
Direct Results Count Pct Average Min Max Total Damage
hit 59.2 62.23% 2788.73 1821 3604 165138
crit 8.8 9.20% 5586.57 3642 7207 48900
glance 22.8 24.00% 2093.19 1366 2703 47801
dodge 4.3 4.53% 0.00 0 0 0
miss 0.0 0.05% 0.00 0 0 0

Action details: claw

Static Values
  • id:91776
  • school:physical
  • resource:energy
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:40.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
  • normalized:false
  • weapon_power_mod:0.060000
  • weapon_multiplier:1.25
melee 689 48.5% 112.1 3.12sec 2204 1667 2236 4470 5767 9.2% 0.0% 4.5% 0.0% 24.1% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
112.05 112.05 0.00 0.00 1.3223 0.0000 246969
Direct Results Count Pct Average Min Max Total Damage
hit 69.7 62.22% 2235.61 1458 2884 155862
crit 10.3 9.16% 4469.59 2915 5767 45893
glance 27.0 24.06% 1677.06 1093 2163 45213
dodge 5.1 4.51% 0.00 0 0 0
miss 0.1 0.05% 0.00 0 0 0

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:energy
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
  • normalized:false
  • weapon_power_mod:0.060000
  • weapon_multiplier:1.00
Resource Usage Res% DPR RPE
frost_strike 100.0% 639.6 32
pet - army_of_the_dead_ghoul_8
claw 100.0% 16.7 40
pet - ghoul
claw 100.0% 68.8 40


Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
blood_fury_ap 3.8 0.0 120.5sec 120.5sec 14% 14%

Database details

  • id:
  • cooldown name:buff_blood_fury_ap
  • tooltip:(null)
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
bloodlust 1.0 0.0 0.0sec 0.0sec 10% 10%

Database details

  • id:
  • cooldown name:buff_bloodlust
  • tooltip:(null)
  • max_stacks:1
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
crushing_weight 7.3 0.0 58.0sec 58.0sec 27% 27%

Database details

  • id:
  • cooldown name:buff_crushing_weight
  • tooltip:(null)
  • max_stacks:1
  • duration:15.00
  • cooldown:50.00
  • default_chance:10.00%
golemblood_potion 2.0 0.0 315.7sec 315.7sec 11% 11%

Database details

  • id:
  • cooldown name:buff_golemblood_potion
  • tooltip:(null)
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
heart_of_rage 4.2 0.0 108.0sec 108.0sec 20% 20%

Database details

  • id:
  • cooldown name:buff_heart_of_rage
  • tooltip:(null)
  • max_stacks:1
  • duration:20.00
  • cooldown:100.00
  • default_chance:10.00%
killing_machine 60.5 2.7 6.6sec 6.3sec 15% 25%

Database details

  • id:
  • cooldown name:buff_killing_machine
  • tooltip:(null)
  • max_stacks:1
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
pillar_of_frost 7.1 0.0 61.7sec 61.7sec 34% 34%

Database details

  • id:
  • cooldown name:buff_pillar_of_frost
  • tooltip:(null)
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
rime 36.4 1.2 11.0sec 10.6sec 15% 54%

Database details

  • id:
  • cooldown name:buff_rime
  • tooltip:(null)
  • max_stacks:1
  • duration:30.00
  • cooldown:0.00
  • default_chance:45.00%
rune_of_the_fallen_crusader 6.7 54.9 60.3sec 6.5sec 90% 89%

Database details

  • id:
  • cooldown name:buff_rune_of_the_fallen_crusader
  • tooltip:(null)
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
tier11_4pc_melee 2.6 24.0 128.8sec 14.7sec 93% 100%

Database details

  • id:
  • cooldown name:buff_tier11_4pc_melee
  • tooltip:(null)
  • max_stacks:3
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
ghoul-bloodlust 0.5 0.0 0.0sec 0.0sec 3% 3%

Database details

  • id:
  • cooldown name:buff_bloodlust
  • tooltip:(null)
  • max_stacks:1
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
Constant Buffs

Database details

  • id:
  • cooldown name:buff_arcane_brilliance
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%

Database details

  • id:
  • cooldown name:buff_blessing_of_kings
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%

Database details

  • id:
  • cooldown name:buff_blessing_of_might
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%

Database details

  • id:
  • cooldown name:buff_blessing_of_might_regen
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%

Database details

  • id:54646
  • cooldown name:buff_focus_magic
  • tooltip:Chance to critically hit with spells increased by $s1%. When a critical hit occurs, the caster's chance to critically hit is increased.
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%

Database details

  • id:
  • cooldown name:buff_fortitude
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%

Database details

  • id:57669
  • cooldown name:buff_replenishment
  • tooltip:Replenishes $s1% of maximum mana per 10 sec.
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%

Database details

  • id:
  • cooldown name:buff_unholy_presence
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%




Count Interval
runic_empowerment 70.9 5.6sec
runic_empowerment_wasted 1.6 123.8sec


Count runic_power Average Overflow
butchery 1613.0 80.0 0.0 0.8%
chill_of_the_grave 151.5 1497.9 9.9 1.1%
horn_of_winter 9.7 97.1 10.0 0.0%
improved_frost_presence 167.0 101.8 0.6 0.3%
might_of_the_frozen_wastes 89.7 888.0 9.9 1.0%
power_refund 0.1 2.2 28.8 0.0%
rune_abilities 167.0 2536.3 15.2 0.7%
pet - army_of_the_dead_ghoul_8 energy
energy_regen 443.0 0.0%
pet - ghoul energy
energy_regen 3584.7 0.0%

Action Priority List

# action,conditions
0 flask,type=titanic_strength
1 food,type=beer_basted_crocolisk
2 presence,choose=unholy
3 army_of_the_dead
4 snapshot_stats
5 blood_fury,time>=10
6 golemblood_potion,if=!in_combat|buff.bloodlust.react|target.time_to_die<=60
7 auto_attack
8 pillar_of_frost
9 raise_dead,if=buff.heart_of_rage.react&buff.rune_of_the_fallen_crusader.react
A raise_dead,time>=15
B outbreak,if=dot.frost_fever.remains<=2|dot.blood_plague.remains<=2
C howling_blast,if=dot.frost_fever.remains<=2
D plague_strike,if=dot.blood_plague.remains<=2
E obliterate,if=frost=2&unholy=2
F obliterate,if=death=2
G obliterate,if=buff.killing_machine.react
H blood_tap,if=buff.killing_machine.react
I empower_rune_weapon,if=target.time_to_die<=120&buff.killing_machine.react
J blood_strike,if=blood=2
K frost_strike,if=runic_power>=90&!buff.bloodlust.react
L frost_strike,if=runic_power>=95
M howling_blast,if=buff.rime.react
N howling_blast,if=(death+unholy)=0
O obliterate
P empower_rune_weapon,if=target.time_to_die<=45
Q frost_strike
R howling_blast
S blood_tap
T blood_strike,if=death=0
U empower_rune_weapon
V horn_of_winter

Sample Sequence



Raid-Buffed Unbuffed Gear Amount
Strength 7046 5685 5012
Agility 721 138 20
Stamina 7047 6038 5863
Intellect 55 53 20
Spirit 85 85 20
Health 141627 127557 0
Mana 120 120 0
Spell Power 0 0 0
Spell Hit 18.32% 18.32% 955
Spell Crit 11.29% 3.29% 590
Spell Haste 20.82% 15.06% 1929
Spell Penetration 0 0 0
Mana Per 5 0 0 0
Attack Power 16745 12501 190
Melee Hit 7.95% 7.95% 955
Melee Crit 11.25% 3.86% 590
Melee Haste 26.57% 15.06% 1929
Expertise 26.24 26.24 788
Armor 21168 21168 21168
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 5.34% 3.98% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 15.01 15.01 1257


head magma_plated_helmet,heroic=1,type=plate,ilevel=372,quality=epic,stats=2891armor_197exp_257haste_578sta_325str,reforge=exp_hit,gems=reverberating_shadowspirit_20haste_20str_30str,enchant=60str_35mastery
neck rage_of_ages,heroic=1,ilevel=372,quality=epic,stats=143hit_143mastery_322sta_215str,reforge=mastery_haste
shoulders magma_plated_pauldrons,heroic=1,type=plate,ilevel=372,quality=epic,stats=2669armor_191haste_171hit_429sta_266str,gems=40str_10haste,enchant=50str_25crit
shirt empty
chest battleplate_of_ancient_kings,heroic=1,type=plate,ilevel=372,quality=epic,stats=3559armor_217exp_257haste_578sta_345str,reforge=exp_mastery,gems=40str_40str,enchant=20all
waist sky_strider_belt_of_the_faultline,heroic=1,type=plate,ilevel=372,quality=epic,stats=2002armor_429sta_266str_180haste_180mastery,gems=40str_67str,suffix=223
legs magma_plated_legplates,heroic=1,type=plate,ilevel=372,quality=epic,stats=3114armor_217hit_257mastery_578sta_345str,reforge=mastery_haste,gems=40str_40str,enchant=190ap_55crit
feet massacre_treads,heroic=1,type=plate,ilevel=372,quality=epic,stats=2447armor_171exp_191mastery_429sta_266str,reforge=exp_haste,gems=40str,enchant=50haste
wrists bracers_of_the_matredor,heroic=1,type=plate,ilevel=379,quality=epic,stats=1589armor_153crit_113haste_344sta_229str,reforge=crit_hit,gems=40str_67str,enchant=50str
hands magma_plated_gauntlets,heroic=1,type=plate,ilevel=372,quality=epic,stats=2224armor_191haste_171mastery_429sta_266str,gems=40str_67str,enchant=50str
finger1 dargonaxs_signet,heroic=1,ilevel=379,quality=epic,stats=113crit_153mastery_344sta_229str,reforge=crit_haste,gems=40str
finger2 ring_of_rivalry,heroic=1,ilevel=372,quality=epic,stats=143haste_143mastery_322sta_215str
trinket1 crushing_weight,heroic=1,ilevel=372,quality=epic,stats=363str,equip=onattackhit_2178haste_10%_15dur_50cd
trinket2 heart_of_rage,heroic=1,ilevel=372,quality=epic,stats=363exp,equip=onattackhit_2178str_10%_20dur_100cd
back glittering_epidermis,heroic=1,ilevel=372,quality=epic,stats=673armor_143crit_143haste_322sta_215str,reforge=crit_mastery,enchant=65crit
main_hand reclaimed_ashkandi_greatsword_of_the_brotherhood,heroic=1,ilevel=372,quality=epic,stats=257crit_257hit_578sta_385str,reforge=crit_haste,enchant=rune_of_the_fallen_crusader,weapon=sword2h_3.80speed_2138min_3209max
off_hand empty
ranged relic_of_aggramar,ilevel=359,quality=epic,stats=72crit_72exp_161sta_107str,reforge=crit_hit,gems=40str
tabard tabard_of_ramkahen,ilevel=85


Blood Rank
Butchery 1
Blade Barrier 0
Bladed Armor 3
Improved Blood Tap 0
Scent of Blood 0
Scarlet Fever 0
Hand of Doom 0
Blood-Caked Blade 0
Bone Shield 0
Toughness 0
Abomination's Might 0
Sanguine Fortitude 0
Blood Parasite 0
Improved Blood Presence 0
Will of the Necropolis 0
Rune Tap 0
Vampiric Blood 0
Improved Death Strike 0
Crimson Scourge 0
Dancing Rune Weapon 0
Frost Rank
Runic Power Mastery 3
Icy Reach 2
Nerves of Cold Steel 0
Annihilation 3
Lichborne 1
On a Pale Horse 0
Endless Winter 1
Merciless Combat 2
Chill of the Grave 2
Killing Machine 3
Rime 3
Pillar of Frost 1
Improved Icy Talons 1
Brittle Bones 2
Chilblains 0
Hungering Cold 1
Improved Frost Presence 2
Threat of Thassarian 0
Might of the Frozen Wastes 3
Howling Blast 1
Unholy Rank
Unholy Command 0
Virulence 3
Epidemic 3
Desecration 0
Resilient Infection 0
Morbidity 0
Runic Corruption 0
Unholy Frenzy 0
Contagion 0
Shadow Infusion 0
Death's Advance 0
Magic Suppression 0
Rage of Rivendare 0
Unholy Blight 0
Anti-Magic Zone 0
Improved Unholy Presence 0
Dark Transformation 0
Ebon Plaguebringer 0
Sudden Doom 0
Summon Gargoyle 0



# Gear Summary # gear_strength=5012
# gear_agility=20
# gear_stamina=5863
# gear_intellect=20
# gear_spirit=20
# gear_attack_power=190
# gear_expertise_rating=788
# gear_hit_rating=955
# gear_crit_rating=590
# gear_haste_rating=1929
# gear_mastery_rating=1257
# gear_armor=21168
# meta_gem=reverberating_shadowspirit
# tier11_2pc_melee=1
# tier11_4pc_melee=1
# main_hand=reclaimed_ashkandi_greatsword_of_the_brotherhood,heroic=1,weapon=sword2h_3.80speed_2138min_3209max,enchant=rune_of_the_fallen_crusader


Dynamic Buff Start Refresh Interval Trigger Up-Time Benefit
horn_of_winter 1.0 0.0 0.0sec 0.0sec 45% 43%
Constant Buff

Fluffy_Pillow : 0dps

Results, Spec and Gear

DPS Error Range Convergence DPR RPS Out RPS In Resource Waiting APM
0.0 0.0 / 0.0% 0.0 / 0.0% 0.0% 0.0 54363.9 0.0 health 100.02% 0.0



Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Max Crit% M% D% P% G% B% Ticks T-Hit T-Crit T-Crit% T-M% Up%
Fluffy_Pillow 0
Resource Usage Res% DPR RPE


Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
Constant Buffs

Database details

  • id:
  • cooldown name:buff_bleeding
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%

Database details

  • id:
  • cooldown name:buff_blood_frenzy_physical
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%

Database details

  • id:
  • cooldown name:buff_brittle_bones
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%

Database details

  • id:22959
  • cooldown name:buff_critical_mass
  • tooltip:Spells have a $s1% additional chance to critically hit.
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%

Database details

  • id:60433
  • cooldown name:buff_earth_and_moon
  • tooltip:Increases spell damage taken by $s1%.
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%

Database details

  • id:1130
  • cooldown name:buff_hunters_mark
  • tooltip:All attackers gain $s2 ranged attack power against this target.
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%

Database details

  • id:
  • cooldown name:buff_mangle
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%

Database details

  • id:
  • cooldown name:buff_poisoned
  • tooltip:(null)
  • max_stacks:-1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%

Database details

  • id:57669
  • cooldown name:buff_replenishment
  • tooltip:Replenishes $s1% of maximum mana per 10 sec.
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%

Database details

  • id:58567
  • cooldown name:buff_sunder_armor
  • tooltip:Armor decreased by $s1%.
  • max_stacks:3
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%

Database details

  • id:
  • cooldown name:buff_thunder_clap
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%




Count Interval


Count health Average Overflow

Action Priority List

# action,conditions
0 snapshot_stats


Raid-Buffed Unbuffed Gear Amount
Strength 0 0 0
Agility 0 0 0
Stamina 0 0 0
Intellect 0 0 0
Spirit 0 0 0
Health 0 27400743 0
Mana 0 0 0
Spell Power 0 0 0
Spell Hit 0.00% 0.00% 0
Spell Crit 0.00% 0.00% 0
Spell Haste 0.00% 0.00% 0
Spell Penetration 0 0 0
Mana Per 5 0 0 0
Attack Power 0 0 0
Melee Hit 0.00% 0.00% 0
Melee Crit 5.00% 5.00% 0
Melee Haste 0.00% 0.00% 0
Expertise 0.00 0.00 0
Armor 10540 11977 0
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 0.00% 0.00% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 5.00% 5.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 0.00 0.00 0


head empty
neck empty
shoulders empty
shirt empty
chest empty
waist empty
legs empty
feet empty
wrists empty
hands empty
finger1 empty
finger2 empty
trinket1 empty
trinket2 empty
back empty
main_hand empty
off_hand empty
ranged empty
tabard empty




# Gear Summary


Average number of actions executed per minute.

Constant Buffs

Buffs received prior to combat and present the entire fight.


Average number of times an action is executed per iteration.


Average crit damage.


Percentage of executes that resulted in critical strikes.


Percentage of executes that resulted in dodges.


Average damage per execution of an individual action.


Average damage per execute time of an individual action; the amount of damage generated, divided by the time taken to execute the action, including time spent in the GCD.


Average damage per resource point spent.


Average damage per second.


Percentage of total DPS contributed by a particular action.

Dynamic Buffs

Temporary buffs received during combat, perhaps multiple times.


( 2 * dps_stddev / sqrt( iterations ) ) / dps_avg


Rate at which increasing iterations reduces error


Percentage of executes that resulted in glancing blows.


Percentage of executes that resulted in blocking blows.


Average non-crit damage.


Average time between executions of a particular action.


Maximum crit damage over all iterations.


Percentage of executes that resulted in misses.


The player profile from which the simulation script was generated. The profile must be copied into the same directory as this HTML file in order for the link to work.


Percentage of executes that resulted in parries.


( dps_max - dps_min ) / ( 2 * dps_avg )


Average resource points generated per second.


Average resource points consumed per second.

Scale Factors

DPS gain per unit stat increase except for Hit/Expertise which represent DPS loss per unit stat decrease.


Average number of periodic ticks per iteration. Spells that do not have a damage-over-time component will have zero ticks.


Average crit tick damage.


Percentage of ticks that resulted in critical strikes.


Average non-crit tick damage.


Percentage of ticks that resulted in misses.


Percentage of total time that DoT is ticking on target.

Timeline Distribution

The simulated encounter's duration can vary based on the health of the target and variation in the raid DPS. This chart shows how often the duration of the encounter varied by how much time.

Fight Length

Fight Length: 450
Vary Combat Length: 0.20

Fight Length is the specified average fight duration. If vary_combat_length is set, the fight length will vary by +/- that portion of the value. See Combat Length in the wiki for further details.


This is the percentage of time in which no action can be taken other than autoattacks. This can be caused by resource starvation, lockouts, and timers.